Semaglutide Biosimilar
Catalog #500057
| Cat # | Size | Price | Quantity | |
|---|---|---|---|---|
| 500057 | 20 mg | $175.00 | ||
| 500057 | 60 mg | $350.00 | ||
| 500057 | 180 mg | $700.00 |
Product Details
The recombinant peptide semaglutide biosimilar was produced in the semaglutide stable cell line. Sequence: HXEGTFTSDVSSYLEGQAAKEFIAWLVRGRG. Semaglutide is a GLP-1 receptor agonist, known for its ability to improve insulin sensitivity and promote weight loss, primarily through its extended half-life compared to other GLP-1 drugs like liraglutide. These characteristics make semaglutide an effective treatment for both diabetes and obesity.
Specifications
| Clone | Semaglutide |
|---|---|
| Reactivities | Human |
| Format | Lyophilized |
| Formluation | PBS, pH 7.4 |
| Sterility | 0.2 µm filtered |
| Clonality | Recombinant |
| Conjugation | Unconjugated |
| Host | CHO cells |
| Purity | >95% (HPLC, SDS-PAGE) |
| Endotoxin | < 1.0 EU/mg (LAL assay) |
| Grade | In vivo ready (RUO) |
| Application | Neutralization; Flow Cytometry; ELISA; WB |
| Purification | Protein A |
| Storage Conditions | 2-8 °C, Avoid freeze / thaw cycle |
| Shelf Life | 6 months |
| Regulatory Status | RUO |